DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and NKX1-1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001277008.1 Gene:NKX1-1 / 54729 HGNCID:24975 Length:448 Species:Homo sapiens


Alignment Length:306 Identity:92/306 - (30%)
Similarity:122/306 - (39%) Gaps:83/306 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DSELELSNDDSDIDIEDRSTPDSTAAGCQQELLLSHHHRRFTHHDESSVESCLSATRGPGSGTGS 87
            ||..|:.:|:.|   ::...|::.||                                .|:....
Human   185 DSGDEVPDDEDD---DEDEAPETEAA--------------------------------RGAEEAR 214

  Fly    88 GGGGGGGGGGGVASGLSAAAAAAGVAAGLLAA--------AASGANGDRDANGGSGPGSGGGTSG 144
            |||||.|..|....|.:...|:.|......||        .|.|..|...|.||:|....|..:.
Human   215 GGGGGLGARGSGCQGAAETDASPGATVDEAAAPGPRENSPVAQGPPGGAAAPGGAGTTPQGTATA 279

  Fly   145 GYAEHKL--QLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTW 207
            ...:.|.  ..|||| ||||.|||||:.||..||.||:..:||||.:|.::|.:|:|:|||||.|
Human   280 AKPKRKRTGSDSKSG-KPRRARTAFTYEQLVALENKFKATRYLSVCERLNLALSLSLTETQVKIW 343

  Fly   208 YQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAG-------GLGCCPSGLS---------- 255
            :||||||||:||.            ..|.....|||.|       |.| .|.|||          
Human   344 FQNRRTKWKKQNP------------GADTSAPTGGGGGPGPGAGPGTG-LPGGLSPLSPSPPMGA 395

  Fly   256 -------SSFSAAAAAAAAASNPCNFLTSAAAAAIFRNVGYVHGCP 294
                   :.:.|........:....||:|.|..:.|......:|.|
Human   396 PLGMHGPAGYPAHGPGGLVCAAQLPFLSSPAVLSPFVLGSQTYGAP 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 31/52 (60%)
NKX1-1NP_001277008.1 Homeobox 300..352 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.