DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Rhox3g

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001138878.1 Gene:Rhox3g / 546294 MGIID:3770313 Length:160 Species:Mus musculus


Alignment Length:170 Identity:49/170 - (28%)
Similarity:70/170 - (41%) Gaps:44/170 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DESSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGANGDRDAN 131
            |...|||.|.||...|.|               ...|:..:.||...|||:         :.|.|
Mouse    20 DGGQVESALGATAARGRG---------------KEALNGESPAAAGTAGLV---------EEDRN 60

  Fly   132 GGSGPGSGGGTSGG-------------YAEHKLQLSKSGRK-PRRR-RTAFTHAQLAYLERKFRC 181
                 ...|||.||             :.|.:...:::.|: |||| ...||..||..|||.||.
Mouse    61 -----KEDGGTKGGEKNEQEVREQIPEHVEGESDQAEAPRQVPRRRLHHRFTQWQLDELERIFRM 120

  Fly   182 QKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQL 221
            ..:||:..|..:|..:.::|..||.|:|.||.:::...:|
Mouse   121 NYFLSLEARKQLARWMGVNEAIVKRWFQKRREQYRWYKRL 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 21/53 (40%)
Rhox3gNP_001138878.1 homeodomain 100..156 CDD:238039 22/55 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.