DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Barhl1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001157658.1 Gene:Barhl1 / 54422 MGIID:1859288 Length:327 Species:Mus musculus


Alignment Length:258 Identity:85/258 - (32%)
Similarity:112/258 - (43%) Gaps:84/258 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLGDLINRRQTDSELELS-NDDSDIDIEDRSTPDSTAAGCQQELLLSHHHRRFTHHDESSVESCL 75
            ||||      ..|.|||| ..:|.   .|.|:|.|....|.:                       
Mouse    28 LLGD------CRSPLELSPRSESS---SDCSSPASPGRDCLE----------------------- 60

  Fly    76 SATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGL-----------LAAAASGANGDRD 129
            ::|..||:.:|.|.......|     .|||.|.:..|.:..           |||.|..::..:.
Mouse    61 TSTSRPGAASGPGLDSHLQPG-----QLSAPAQSRTVTSSFLIRDILADCKPLAACAPYSSSGQP 120

  Fly   130 ANGGSGPGSGG------------------GTSGGYAEHKL------QLSKSG-------RKPRRR 163
            |    .|..||                  .::...:|:|:      ::|.|.       :|||:.
Mouse   121 A----APEPGGRLAAKAGEDFRDKLDKSVSSASSDSEYKVKEEGDREISSSRDSPPVRLKKPRKA 181

  Fly   164 RTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQL 226
            |||||..|||.|||.|..||||||.||.::|.:|||::|||||||||||||||||..:.||.|
Mouse   182 RTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTKWKRQTAVGLELL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 37/52 (71%)
Barhl1NP_001157658.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90 25/98 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..181 11/71 (15%)
Homeobox 182..235 CDD:395001 38/52 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1387
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.