DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Dbx2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_001053826.1 Gene:Dbx2 / 541457 RGDID:1359605 Length:377 Species:Rattus norvegicus


Alignment Length:131 Identity:46/131 - (35%)
Similarity:67/131 - (51%) Gaps:15/131 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 GGSGPGSGGGTSGGYAEHKLQL--SKSGRKPRR---RRTAFTHAQLAYLERKFRCQKYLSVADRS 191
            |||.......|:....||.|.|  ..|..|.||   ||..|:..|...||:.|:.|||:|..||.
  Rat   193 GGSCRRPASPTAFSREEHGLPLLTQDSNSKARRGILRRAVFSEDQRKALEKMFQKQKYISKTDRR 257

  Fly   192 DVAETLNLSETQVKTWYQNRRTKWK--RQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGC---CP 251
            .:|.:|.|.|:|||.|:||||.||:  ::.::...:...:.::::|.:.|...     ||   ||
  Rat   258 KLAISLGLKESQVKIWFQNRRMKWRNSKEKEVLSNRCLQEVSLQEDRLAQPAA-----GCPPQCP 317

  Fly   252 S 252
            |
  Rat   318 S 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 26/52 (50%)
Dbx2XP_001053826.1 Homeobox 229..282 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.