DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and PITX3

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_005020.1 Gene:PITX3 / 5309 HGNCID:9006 Length:302 Species:Homo sapiens


Alignment Length:292 Identity:70/292 - (23%)
Similarity:100/292 - (34%) Gaps:108/292 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 GLSAAAAAAGVAAGLLAAAA-------SGANGDR--DANGGSGPGSGGGTSGGYAEHKLQLSKSG 157
            ||.:.|.|...|..|..|..       .|..|..  |:...|....||....|..:         
Human     4 GLLSEAEARSPALSLSDAGTPHPQLPEHGCKGQEHSDSEKASASLPGGSPEDGSLK--------- 59

  Fly   158 RKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQ---- 218
            :|.||:||.||..||..||..|:..:|..::.|.::|...||:|.:|:.|::|||.||:::    
Human    60 KKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERSQ 124

  Fly   219 --------------------------------------------------NQLRLEQLRHQ---- 229
                                                              |.:.:..|..|    
Human   125 QAELCKGSFAAPLGGLVPPYEEVYPGYSYGNWPPKALAPPLAAKTFPFAFNSVNVGPLASQPVFS 189

  Fly   230 ------ATMEKDFVVQDG-----GGAGGLGCCPSGLSSS-----------FSAAAAAAAAAS--- 269
                  |:|........|     |...|||..|.||:.:           .|||||||||||   
Human   190 PPSSIAASMVPSAAAAPGTVPGPGALQGLGGGPPGLAPAAVSSGAVSCPYASAAAAAAAAASSPY 254

  Fly   270 ---NPCNFLTSAAAAAIFRNVGY----VHGCP 294
               :|||...::......::..:    |||.|
Human   255 VYRDPCNSSLASLRLKAKQHASFSYPAVHGPP 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 21/52 (40%)
PITX3NP_005020.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71 20/75 (27%)
Homeobox 66..119 CDD:395001 22/52 (42%)
OAR 258..275 CDD:397759 3/16 (19%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 262..275 0/12 (0%)
Nuclear localization signal. /evidence=ECO:0000255 268..272 0/3 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.