DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Tlx1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001102636.1 Gene:Tlx1 / 499361 RGDID:1563655 Length:333 Species:Rattus norvegicus


Alignment Length:203 Identity:67/203 - (33%)
Similarity:93/203 - (45%) Gaps:54/203 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 TRGPGSGTGSGGGGG------------------------GGGGGGVASGLSAAAAAAGV------ 112
            |.|||...|..||||                        ||||||..:|.:.|.:||||      
  Rat    76 TGGPGGPGGPAGGGGGACSMGPLAGSYNVNMALAGGPGPGGGGGGAGAGGAGALSAAGVIRVPAH 140

  Fly   113 --AAGLLA---------------AAASGANGDRDANGGSGPGSGGG---TSGGYAEHKLQLSKSG 157
              .||.:|               .|..|.|   :..|.:.|.....   |...:..|..| :::.
  Rat   141 RPLAGAVAHPQPLATGLPTVPSVPAVPGVN---NLTGLTFPWMESNRRYTKDRFTGHPYQ-NRTP 201

  Fly   158 RKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLR 222
            .|.::.||:||..|:..||::|..||||:.|:|:.:|:.|.:::.|||||:|||||||:||....
  Rat   202 PKKKKPRTSFTRLQICELEKRFHRQKYLASAERAALAKALKMTDAQVKTWFQNRRTKWRRQTAEE 266

  Fly   223 LEQLRHQA 230
            .|..|.||
  Rat   267 REAERQQA 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 27/52 (52%)
Tlx1NP_001102636.1 Homeobox 207..260 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.