DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Tlx3

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_573065.4 Gene:Tlx3 / 497881 RGDID:1564190 Length:291 Species:Rattus norvegicus


Alignment Length:204 Identity:62/204 - (30%)
Similarity:87/204 - (42%) Gaps:49/204 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ATRGPGSGTGSGGGGGGGGGGGVAS------GLSAAAAAAGVAAGLLAAAASG---ANGDRDANG 132
            |.|||...:..||..||..|....|      ||.|....||..:..|:.|.:|   ....|...|
  Rat    34 APRGPDGASYLGGPPGGRPGAAYPSLPASFAGLGAPFEDAGSYSVNLSLAPAGVIRVPAHRPLPG 98

  Fly   133 GSGP---------------GSGGGTSGGYAEHKLQLSK----------------------SGRKP 160
            ...|               .|.||.:..:.|...:..|                      ..|.|
  Rat    99 AVPPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFTAAAALTPFTVTRRIGHPYQNRTP 163

  Fly   161 RRR---RTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLR 222
            .:|   ||:|:..|:..||::|..||||:.|:|:.:|::|.:::.|||||:|||||||:||....
  Rat   164 PKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEE 228

  Fly   223 LEQLRHQAT 231
            .|..|.||:
  Rat   229 REAERQQAS 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 27/55 (49%)
Tlx3XP_573065.4 Homeobox 169..223 CDD:395001 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.