Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_006159.2 | Gene: | NKX6-1 / 4825 | HGNCID: | 7839 | Length: | 367 | Species: | Homo sapiens |
Alignment Length: | 255 | Identity: | 64/255 - (25%) |
---|---|---|---|
Similarity: | 95/255 - (37%) | Gaps: | 91/255 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 73 SCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLA------------------- 118
Fly 119 ---AAASGANGD-------------------------RDANGGSGPGSGGGTSGGYAEHKLQLSK 155
Fly 156 SGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQ 220
Fly 221 LRL-----------EQLRHQATMEK---DF------------VVQ-------DGGGAGGL 247 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 24/52 (46%) |
NKX6-1 | NP_006159.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 36..133 | 4/19 (21%) | |
Repressor domain. /evidence=ECO:0000250 | 102..268 | 40/165 (24%) | |||
Homeobox | 239..293 | CDD:395001 | 25/54 (46%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 294..367 | 10/63 (16%) | |||
Involved in DNA-binding. /evidence=ECO:0000250 | 306..367 | 10/51 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |