DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and NKX6-1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_006159.2 Gene:NKX6-1 / 4825 HGNCID:7839 Length:367 Species:Homo sapiens


Alignment Length:255 Identity:64/255 - (25%)
Similarity:95/255 - (37%) Gaps:91/255 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLA------------------- 118
            :.|.:....||.:.|............|:..:||||||...|||||                   
Human   113 AALPSASPSGSSSSSSSSASASSASAAAAAAAAAAAAASSPAGLLAGLPRFSSLSPPPPPPGLYF 177

  Fly   119 ---AAASGANGD-------------------------RDANGGSGPGSGGGTSGGYAEHKLQLSK 155
               |||..|.|.                         |||.....|..|          .:.|.|
Human   178 SPSAAAVAAVGRYPKPLAELPGRTPIFWPGVMQSPPWRDARLACTPHQG----------SILLDK 232

  Fly   156 SGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQ 220
            .|::...|.| |:..|:..||:.|...|||:..:|:.:|.:|.::|:|||.|:|||||||::::.
Human   233 DGKRKHTRPT-FSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHA 296

  Fly   221 LRL-----------EQLRHQATMEK---DF------------VVQ-------DGGGAGGL 247
            ..:           |:|:..:..|:   |:            :.|       ..||.|||
Human   297 AEMATAKKKQDSETERLKGASENEEEDDDYNKPLDPNSDDEKITQLLKKHKSSSGGGGGL 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 24/52 (46%)
NKX6-1NP_006159.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..133 4/19 (21%)
Repressor domain. /evidence=ECO:0000250 102..268 40/165 (24%)
Homeobox 239..293 CDD:395001 25/54 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..367 10/63 (16%)
Involved in DNA-binding. /evidence=ECO:0000250 306..367 10/51 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.