DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and hbn

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster


Alignment Length:345 Identity:83/345 - (24%)
Similarity:118/345 - (34%) Gaps:114/345 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FLIRDLLGD--LINRRQTDSELELSNDDSDIDIEDRSTPDSTAAGCQQELLLSH----HHRRFTH 65
            :.|..:||:  .|.|..|.||:.:::..............|.:.|...   |||    .|.:..|
  Fly    37 YSIDQILGNQHQIKRSDTPSEVLITHPHHGHPHHIHHLHSSNSNGSNH---LSHQQQQQHSQQQH 98

  Fly    66 HDESSVES---CLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGANGD 127
            |.:...:.   .:.|.| ..|.|.:.|                                 |.:.|
  Fly    99 HSQQQQQQQQLQVQAKR-EDSPTNTDG---------------------------------GLDVD 129

  Fly   128 RDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSD 192
            .|....|...:|         |.|...:..||.||.||.||..||..|||.|...:|..|..|.|
  Fly   130 NDDELSSSLNNG---------HDLSDMERPRKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTRED 185

  Fly   193 VAETLNLSETQVKTWYQNRRTKWKRQ----NQLRLEQL---------------------RHQATM 232
            :|..|:|||.:|:.|:||||.||:::    ||.:...|                     .|..:|
  Fly   186 LAMRLDLSEARVQVWFQNRRAKWRKREKFMNQDKAGYLLPEQGLPEFPLGIPLPPHGLPGHPGSM 250

  Fly   233 EKDFVVQ--------DGGGAGGLGCCP-----------------------SGLSSSFSAAAAAAA 266
            :.:|...        :...|...|..|                       |.|:..|.|.|||||
  Fly   251 QSEFWPPHFALHQHFNPAAAAAAGLLPQHLMAPHYKLPNFHTLLSQYMGLSNLNGIFGAGAAAAA 315

  Fly   267 AASN---PCNFLTSAAAAAI 283
            ||::   |.|....|..:|:
  Fly   316 AAASAGYPQNLSLHAGLSAM 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 26/52 (50%)
hbnNP_788420.1 Homeobox 156..209 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.