DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Abd-B

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster


Alignment Length:183 Identity:47/183 - (25%)
Similarity:78/183 - (42%) Gaps:30/183 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PDSTAAGCQQELLLSHHHRRFTHHDESSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAA 107
            ||.|.:.......::...|..:.....|||...:::..|.:.:..     ||..|..:...|::.
  Fly   300 PDQTTSAAAAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSP-----GGLRGYPSENYSSSG 359

  Fly   108 AAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQL 172
            |:.|::.        ||.|....|.|....:|            |:|     .|::|..::..|.
  Fly   360 ASGGLSV--------GAVGPCTPNPGLHEWTG------------QVS-----VRKKRKPYSKFQT 399

  Fly   173 AYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQ 225
            ..||::|....|:|...|.::|..|.|:|.|||.|:||||.|.|:.:|.:..|
  Fly   400 LELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQ 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 21/52 (40%)
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.