DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and AgaP_AGAP010279

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_001238161.2 Gene:AgaP_AGAP010279 / 4578234 VectorBaseID:AGAP010279 Length:354 Species:Anopheles gambiae


Alignment Length:198 Identity:59/198 - (29%)
Similarity:87/198 - (43%) Gaps:29/198 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 AAGVAAGLLA-----AAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFT 168
            :.|:|..|:|     .|:...:...|.|  |.|.|..|  |...:..|..|     .||.|||||
Mosquito    18 SVGLAVDLMAHQYSSKASPPLSPLSDCN--SPPSSDHG--GNNQQPPLDPS-----VRRYRTAFT 73

  Fly   169 HAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATME 233
            ..|||.||::|..:.|:|...|.::|..|||.|:.:|.|:||||.|.|||   |:......|.:.
Mosquito    74 RDQLARLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQ---RIAVAWPYAAVY 135

  Fly   234 KD-----FVVQDGGGAGGL--GCCPSGLSSSFSAAAAAAAAASNPCNFLTSAAAAAIFRNVGYVH 291
            .|     .::|....:.|:  |..|:.:.:............:|     :.:|:|..|...||..
Mosquito   136 SDPAFAASILQAAANSVGMPYGYPPAPMLTQMPVIPPPVVPGAN-----SMSASAHAFTAYGYPR 195

  Fly   292 GCP 294
            ..|
Mosquito   196 YTP 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 26/52 (50%)
AgaP_AGAP010279XP_001238161.2 HOX 66..121 CDD:197696 28/54 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.