DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and AgaP_AGAP003672

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_001230938.3 Gene:AgaP_AGAP003672 / 4576841 VectorBaseID:AGAP003672 Length:527 Species:Anopheles gambiae


Alignment Length:231 Identity:71/231 - (30%)
Similarity:99/231 - (42%) Gaps:40/231 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IDIEDRSTPDSTAAG--CQQELLLSHHHRRFTHHDESSVESCLSATRGPGSGTGSGGGGGGGGGG 97
            |..|..|...|:||.  |..|:     .|...|....|.:|..|...|..:|.|.|.|..|..||
Mosquito   313 IPSESGSERSSSAASDCCSPEI-----GRGSDHQSHQSSQSSSSGVGGGSAGAGDGSGRTGANGG 372

  Fly    98 GVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRR 162
              |||.:.:::........|.|.....|.:.|.:......|.........:.|        |.|:
Mosquito   373 --ASGAAKSSSKTAPNGTPLDALFQMTNKNFDESNEDSEQSHLNLFANRPQPK--------KKRK 427

  Fly   163 RRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLR 227
            .|||||:.|:..||::|..|||||.:||.::|..|.||..||.||:||||.|.||.    :|:|:
Mosquito   428 SRTAFTNHQIFELEKRFLYQKYLSPSDRDEIAAALGLSNAQVITWFQNRRAKLKRD----MEELK 488

  Fly   228 -----------HQATME--------KDFVVQDGGGA 244
                       |:..:|        |..::.|.||:
Mosquito   489 KDVETVKVLSAHKTFLENVNDMNILKKKIMHDDGGS 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 29/52 (56%)
AgaP_AGAP003672XP_001230938.3 Homeobox 428..481 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.