DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and MSX2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_002440.2 Gene:MSX2 / 4488 HGNCID:7392 Length:267 Species:Homo sapiens


Alignment Length:248 Identity:78/248 - (31%)
Similarity:104/248 - (41%) Gaps:79/248 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 GPGSGTGSGGGGGGGGGGG-------------------------VASGLSAAAAAAGVAAGLLAA 119
            ||....|.|.|.||..|..                         .||.|.|.:|:||.....|..
Human    17 GPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVEALMSDKKPPKEASPLPAESASAGATLRPLLL 81

  Fly   120 AASGANGDRDANGGSGP-------------GSGGGTS-----GGYAEHKLQLS---------KSG 157
            :..||   |:|: ..||             .|..|.:     |.|:.....:|         |:.
Human    82 SGHGA---REAH-SPGPLVKPFETASVKSENSEDGAAWMQEPGRYSPPPRHMSPTTCTLRKHKTN 142

  Fly   158 RKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLR 222
            |||   ||.||.:||..||||||.::|||:|:|::.:.:|||:|||||.|:||||.|.||..:..
Human   143 RKP---RTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAE 204

  Fly   223 LEQLRHQATMEKDFVVQDGGGAGGLGCCPSGLSSSFSAA----AAAAAAASNP 271
            ||:|:..|   |..:             ||..|..|..:    ||:...||.|
Human   205 LEKLKMAA---KPML-------------PSSFSLPFPISSPLQAASIYGASYP 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 31/52 (60%)
MSX2NP_002440.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71 12/53 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..147 7/33 (21%)
Homeobox 145..199 CDD:365835 32/56 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.