DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and MSX1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_002439.2 Gene:MSX1 / 4487 HGNCID:7391 Length:303 Species:Homo sapiens


Alignment Length:282 Identity:84/282 - (29%)
Similarity:111/282 - (39%) Gaps:87/282 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GGGGGGGGGGVASGLSAAAAAAG---------VAAGLLAAAASGANGDR---------------- 128
            |...|||.|...|..:|.|||.|         |:..||..:......|.                
Human    22 GKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLPFSVEALMADHRKPGAKESALAPSEGV 86

  Fly   129 DANGGSG------PGSGGG-------------TSGG---YAEHKLQLSKSGRKP----------- 160
            .|.|||.      |||.|.             :.||   ..|..|..::|..||           
Human    87 QAAGGSAQPLGVPPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRF 151

  Fly   161 ---------------------RRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQV 204
                                 |:.||.||.|||..||||||.::|||:|:|::.:.:|:|:||||
Human   152 SPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQV 216

  Fly   205 KTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGCCPSGLSSSFSAAAAAAAAAS 269
            |.|:||||.|.||..:..||:|:..|   |..:..   .|.||.....|.::..:||.|:...||
Human   217 KIWFQNRRAKAKRLQEAELEKLKMAA---KPMLPP---AAFGLSFPLGGPAAVAAAAGASLYGAS 275

  Fly   270 NPCN--FLTSAAAAAIFRNVGY 289
            .|..  .|..|.......:|||
Human   276 GPFQRAALPVAPVGLYTAHVGY 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 31/52 (60%)
MSX1NP_002439.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..55 11/32 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..117 9/47 (19%)
PTZ00449 <105..>248 CDD:185628 46/145 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 133..174 3/40 (8%)
Homeobox 175..229 CDD:395001 31/53 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.