DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and hoxc8

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001006787.1 Gene:hoxc8 / 448482 XenbaseID:XB-GENE-480999 Length:242 Species:Xenopus tropicalis


Alignment Length:211 Identity:56/211 - (26%)
Similarity:80/211 - (37%) Gaps:45/211 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PDSTAAGCQQELLLSHHHRRFTHHDESSVES-------CLSATRGPGSGTGSGGGGGGGGGGGVA 100
            |.:||.|.|..   |||.:.|.||..||:.:       |.....|..|               ..
 Frog    42 PSATAPGFQHP---SHHVQEFFHHGSSSLSNSGFQQNPCALTCHGDAS---------------KF 88

  Fly   101 SGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSG-------- 157
            .|..|....:...|...|:.....:....:|..:..|.|         |..|.|...        
 Frog    89 YGYEALPRQSLYGAQQEASVVQYPDCKSSSNTNTSEGQG---------HLNQNSSPSLMFPWMRP 144

  Fly   158 RKPRRR--RTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQ 220
            ..|.||  |..::..|...||::|....||:...|.:|:..|.|:|.|||.|:||||.|||::|.
 Frog   145 HAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENN 209

  Fly   221 L-RLEQLRHQATMEKD 235
            . :|...|.:...|::
 Frog   210 KDKLPGARDEEKTEEE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 22/54 (41%)
hoxc8NP_001006787.1 Homeobox 153..206 CDD:365835 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.