DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and DBX2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001004329.2 Gene:DBX2 / 440097 HGNCID:33186 Length:339 Species:Homo sapiens


Alignment Length:193 Identity:61/193 - (31%)
Similarity:78/193 - (40%) Gaps:43/193 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 ASGLSAAAAAAGV--AAGLLAAAASGAN------GDRDAN------------------------G 132
            |..:|.|.|..|.  |..:|:.:|..|.      ||||..                        |
Human    89 AEQVSPAGAPYGTRWAFQVLSPSADSARLPGRAPGDRDCTFQPSAPAPSKPFLLSTPPFYSACCG 153

  Fly   133 GSGPGSGGGTSGGYAEHKLQL--SKSGRKPRR---RRTAFTHAQLAYLERKFRCQKYLSVADRSD 192
            ||.......|:....|..|.|  ..|..|.||   ||..|:..|...||:.|:.|||:|..||..
Human   154 GSCRRPASSTAFPREESMLPLLTQDSNSKARRGILRRAVFSEDQRKALEKMFQKQKYISKTDRKK 218

  Fly   193 VAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGC---CPS 252
            :|..|.|.|:|||.|:||||.||:  |....|.|.::...|.. :.:|......||.   |||
Human   219 LAINLGLKESQVKIWFQNRRMKWR--NSKEKEVLSNRCIQEVG-LQEDPLSRSALGFPSPCPS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 26/52 (50%)
DBX2NP_001004329.2 Homeobox 189..242 CDD:278475 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..318
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.