Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002475.1 | Gene: | nkx6.1 / 436748 | ZFINID: | ZDB-GENE-040718-178 | Length: | 312 | Species: | Danio rerio |
Alignment Length: | 238 | Identity: | 63/238 - (26%) |
---|---|---|---|
Similarity: | 88/238 - (36%) | Gaps: | 93/238 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 75 LSATRGPGSGTGSGGGGGGGGGGGV-------ASGLSAAAAA----------------------- 109
Fly 110 -AGVAAGL------------------LAAAASGANGD-----------------------RDANG 132
Fly 133 GSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETL 197
Fly 198 NLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQD 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 24/52 (46%) |
nkx6.1 | NP_001002475.1 | Homeobox | 189..242 | CDD:278475 | 24/53 (45%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |