DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and nkx6.1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001002475.1 Gene:nkx6.1 / 436748 ZFINID:ZDB-GENE-040718-178 Length:312 Species:Danio rerio


Alignment Length:238 Identity:63/238 - (26%)
Similarity:88/238 - (36%) Gaps:93/238 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LSATRGPGSGTGSGGGGGGGGGGGV-------ASGLSAAAAA----------------------- 109
            ||:| ||.|.|.........||..|       :|||||.|:|                       
Zfish    41 LSST-GPASSTSPTATSPNPGGIPVSSPGIKTSSGLSALASAQQCAIATPHGINDILSRPSVACS 104

  Fly   110 -AGVAAGL------------------LAAAASGANGD-----------------------RDANG 132
             ||:.:||                  .|||.:.|...                       |||..
Zfish   105 PAGILSGLPRFSSLSPPPPPGLYFSPSAAAVAVARYPKPLTELPGRTPIFWPGVMQSPHWRDARF 169

  Fly   133 GSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETL 197
            ...|          .::.:.|.|.|::...|.| |:..|:..||:.|...|||:..:|:.:|.:|
Zfish   170 ACSP----------HQNSVLLDKDGKRKHTRPT-FSGQQIFALEKTFEQTKYLAGPERARLAYSL 223

  Fly   198 NLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQD 240
            .::|:|||.|:|||||||::         ||.|.|......||
Zfish   224 GMTESQVKVWFQNRRTKWRK---------RHAAEMASAKKKQD 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 24/52 (46%)
nkx6.1NP_001002475.1 Homeobox 189..242 CDD:278475 24/53 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.