DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and C15

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster


Alignment Length:327 Identity:84/327 - (25%)
Similarity:121/327 - (37%) Gaps:99/327 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DSELELS-NDDSDIDI------EDRSTP-------DSTAAGCQQEL------LL------SHHHR 61
            ||:..:| ...||:|:      ::..||       :.|.:...:.|      ||      ||||.
  Fly    29 DSDSRMSCGSGSDVDMDGGSCYDESETPLSESLQSEQTRSSSSENLPFSISRLLSKPFETSHHHH 93

  Fly    62 RFTHHDESSVESCLSATRGPGSGTGSGGGGGGGG----------------GGGVASGLSAAAAAA 110
            ...:|..||         .|||.:.:...|..|.                ...:|:....:|||.
  Fly    94 NNNNHLLSS---------SPGSSSNNNNSGEKGEEKELLQQEDHDLAYKLATSIANSTYGSAAAL 149

  Fly   111 GVAAGLLAAAASG---------------------------ANGDRDANGGSGPGSGGGTSGGYAE 148
            .....|..:||.|                           |..||.|.........|        
  Fly   150 YSYPHLYPSAAGGHVLRVPPQRTPLTWALPPLHHAALAHQAVKDRLAAAFPIARRIG-------- 206

  Fly   149 HKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRT 213
            |..| :::..|.::.||:||..|:|.||::|..||||:.|:|:.:|..|.:::.|||||:|||||
  Fly   207 HPYQ-NRTPPKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRT 270

  Fly   214 KWKRQNQLRLEQLRHQA----------TMEKDFVVQDG--GGAGGLGCCPSGLSSSFSAAAAAAA 266
            ||:||.....|..|..|          .:.|.|.....  |..||:...|..........|.|:.
  Fly   271 KWRRQTAEEREAERQAANRLMLSLQAEAISKGFAPPSAPLGSQGGVNGAPLAALHGLQPWAEASH 335

  Fly   267 AA 268
            ||
  Fly   336 AA 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 28/52 (54%)
C15NP_476873.2 COG5576 <196..315 CDD:227863 42/127 (33%)
Homeobox 220..273 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45921
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.