DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and lbl

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster


Alignment Length:280 Identity:71/280 - (25%)
Similarity:101/280 - (36%) Gaps:61/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KSFLIRDLLG-----DLINRRQ-----------TDSELELSNDDSDIDIEDRSTPDSTAAGCQQE 53
            |||.|.|:||     |.:.::.           ..:.|.|.|:...|.:.....|.:........
  Fly    53 KSFSIADILGRGHEEDRVEKKPERIAIPNALPGVPAPLALINERLQIPLVPNCPPPAALHTFLSP 117

  Fly    54 LLLSHHHRRFT--------HHDESSVESCLSATRGP-------GSGTGSGGGGGGGGGGGVASGL 103
            .||..:.:|..        .|.::..:.....|..|       ||...|.......|.....|..
  Fly   118 ALLHSYEQRLAWDYQRQLQEHFQAQAQLLRQMTLNPAIIASEDGSSERSQRSSSSNGSTECCSPT 182

  Fly   104 SAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLS-------------- 154
            .|...........:.....  :.:....|.|  .|.|.|.   .:...|||              
  Fly   183 QAEKVEKRSQEDRMEVPKK--SPEEQPKGAS--KSSGDTP---LDALFQLSTKNFDEEQDPATLN 240

  Fly   155 -----KSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTK 214
                 .:.:|.|:.|||||:.|:..||::|..|||||.|||.::|..|.||..||.||:||||.|
  Fly   241 IFATRSNPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAK 305

  Fly   215 WKRQNQLRLEQLRHQATMEK 234
            .||.    :|:|:.....||
  Fly   306 LKRD----MEELKKDVQCEK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 30/52 (58%)
lblNP_001262805.1 COG5576 206..332 CDD:227863 46/125 (37%)
Homeobox 254..307 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.