DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and CG15696

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster


Alignment Length:173 Identity:48/173 - (27%)
Similarity:69/173 - (39%) Gaps:44/173 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 AAAGVAAGLLAAA-----ASGANGDRDANGGSGPGSGGGTS---------GGYAEHKLQLSKSGR 158
            |:.||...|.|:.     |..|:.....:|||.|.|.....         ..|...||..:....
  Fly    22 ASLGVLQRLRASLPFHPYAHPASYVSKESGGSPPASAAEAQIPVYDWLQYTRYHPPKLPRALRQN 86

  Fly   159 KPRRR------RTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKR 217
            .|.:|      |..||..||..||..::...|||..|.:.:|::|.|:.|:||.|:||||.:.:|
  Fly    87 APAKRTPGRLPRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERR 151

  Fly   218 QNQLRLEQLRHQATMEKDFVVQDGGGAGGLGCCPSGLSSSFSA 260
            :.:            |||            ..|.|..||:.|:
  Fly   152 EKR------------EKD------------ESCDSTFSSNASS 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 23/58 (40%)
CG15696NP_650921.1 Homeobox 97..144 CDD:278475 18/46 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I3229
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.