DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and MEOX1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_004518.1 Gene:MEOX1 / 4222 HGNCID:7013 Length:254 Species:Homo sapiens


Alignment Length:192 Identity:60/192 - (31%)
Similarity:76/192 - (39%) Gaps:47/192 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 STPDSTAAGCQQELLLSHHHRRFT-----HHDESSVESCLSATRGPGSGTGSGGGGGGGGGGGVA 100
            :||.|..   |:|.:.:..|..|.     |...|      .|.|.|.||.    .||....|..:
Human    69 ATPHSLP---QEEHIFTEQHPAFPQSPNWHFPVS------DARRRPNSGP----AGGSKEMGTSS 120

  Fly   101 SGLSAAAAAAGVAAGLLAAAASGA----------NGDRDANGGSGPGSGGGTSGGYAEHKLQLSK 155
            .||.......|...|:|.:.|:..          :.|...|.|...||.                
Human   121 LGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSS---------------- 169

  Fly   156 SGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKR 217
               |.|:.|||||..||..||.:|....||:...|.::|..|:|||.|||.|:||||.||||
Human   170 ---KARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKR 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 27/52 (52%)
MEOX1NP_004518.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..178 26/120 (22%)
Homeobox 175..227 CDD:306543 27/51 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..254 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.