DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and CG18599

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster


Alignment Length:353 Identity:83/353 - (23%)
Similarity:119/353 - (33%) Gaps:133/353 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 QQELLLSHHHRRF-THHDESSVESCLSATRGPGSGTGSGGGGGG--GGGGGVASGLSAAAAAAGV 112
            ||:....|||::. |||.:.......:.|.|..:...|......  .........|:||||.|..
  Fly    87 QQQQQQHHHHQQLHTHHQDGHHPHPPTPTTGNNNNNSSSSSNSSSHNSNSNHREQLAAAAATATS 151

  Fly   113 AAGLLAAAASGA----------------------------------------------------N 125
            .|.|:.|||:.:                                                    |
  Fly   152 HAQLIEAAAAHSSLDVGKSFTIAAILGLQSQRKDYNNAINLSLHDNNNIIGDDNNKCYTSNPNNN 216

  Fly   126 GDRDANGGSGPG----------------SGGG--TSGG--------------------------- 145
            .:.:.||||..|                :|.|  ..||                           
  Fly   217 NNNNNNGGSNSGNNNSSPSVNNFNCDSVAGNGRYLHGGHQHPHPHQAGFAAVAAAVGAAPSALQS 281

  Fly   146 --------YAEHKLQLS------------KSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADR 190
                    :|:.:..||            ||..|.:|.||.||..||..||.:|..|:|:...:|
  Fly   282 LQQLHQQHHAQQQATLSFQREKLKSDSHKKSALKNKRVRTIFTPEQLECLEAEFERQQYMVGPER 346

  Fly   191 SDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGCCPSGLS 255
            ..:|.||.|:|.|||.|:||||.|| |::.|.|.|.|.....:...     .|...||   :.:|
  Fly   347 LYLAHTLKLTEAQVKVWFQNRRIKW-RKHHLELTQQRLALIRQTQL-----PGTSLLG---NQVS 402

  Fly   256 SSFSAAAAAAAAASNPCNFLTSAAAAAI 283
            .|.:||.:.:...:|.|    |||:.::
  Fly   403 VSANAAHSVSTERTNGC----SAASPSL 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 26/52 (50%)
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.