DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Ubx

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:374 Identity:88/374 - (23%)
Similarity:120/374 - (32%) Gaps:176/374 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 STAAGCQQELLLS-------HHHRRFTHHD---ESSVESCLSATRGPGSGT-------------- 85
            |.||...:...||       :||.:.|..|   ::|:.:..:...|.|:|.              
  Fly    34 SAAAAAYRGFPLSLGMSPYANHHLQRTTQDSPYDASITAACNKIYGDGAGAYKQDCLNIKADAVN 98

  Fly    86 ---------GSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGAN---------------- 125
                     ||.||||||||||  .|.:.....||.|.|..||.|:|.|                
  Fly    99 GYKDIWNTGGSNGGGGGGGGGG--GGGAGGTGGAGNANGGNAANANGQNNPAGGMPVRPSACTPD 161

  Fly   126 ----GDRDANGGS-----------------GPGSGGGT-------------------SGGYAE-- 148
                |..|.:|||                 |.|:.||.                   ||..|:  
  Fly   162 SRVGGYLDTSGGSPVSHRGGSAGGNVSVSGGNGNAGGVQSGVGVAGAGTAWNANCTISGAAAQTA 226

  Fly   149 -----HKLQ-------LSKSGRKP----------------------------------------- 160
                 |:..       ::.:|..|                                         
  Fly   227 AASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGT 291

  Fly   161 ----RRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQL 221
                ||.|..:|..|...||::|....||:...|.::|..|.|:|.|:|.|:||||.|.|::.|.
  Fly   292 NGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQA 356

  Fly   222 --RLEQLRHQATMEKDFVVQDGGGAGGLGCCPSGLSSSFSAAAAAAAAA 268
              .|.:...||..:|                        :|||||||||
  Fly   357 IKELNEQEKQAQAQK------------------------AAAAAAAAAA 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 21/52 (40%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.