powered by:
Protein Alignment CG11085 and Ubx
DIOPT Version :10
| Sequence 1: | NP_572815.3 |
Gene: | CG11085 / 32213 |
FlyBaseID: | FBgn0030408 |
Length: | 295 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_536752.1 |
Gene: | Ubx / 42034 |
FlyBaseID: | FBgn0003944 |
Length: | 389 |
Species: | Drosophila melanogaster |
| Alignment Length: | 32 |
Identity: | 9/32 - (28%) |
| Similarity: | 13/32 - (40%) |
Gaps: | 11/32 - (34%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 182 VIDYDEFTYMVK-----------NYMTDDDIV 202
|:|:..||.|.. .|:.|.|:|
Fly 69 VVDFMHFTAMFPVAVILCGMFWGFYVYDSDLV 100
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG11085 | NP_572815.3 |
Homeodomain |
161..217 |
CDD:459649 |
9/32 (28%) |
| Ubx | NP_536752.1 |
Homeodomain |
296..352 |
CDD:459649 |
|
|
Blue background indicates that the domain is not in
the aligned region.
|
Return to query results.
Submit another query.
