DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and NK7.1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster


Alignment Length:252 Identity:66/252 - (26%)
Similarity:94/252 - (37%) Gaps:86/252 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 VASGLSAAAAAAGVAAGLLAAAASG----------ANGDRDANGGSGPG---------------S 138
            ||...|||.|||.|||.:.||..:.          ....||:|....|.               |
  Fly   253 VAGATSAATAAAAVAATITAATVATPLDQPLNLCVVKKSRDSNNSPMPATKQSQILGKSATKKES 317

  Fly   139 GG----------------------GTSGGYAEHKLQLSKS------------------------- 156
            .|                      |:|......||..:.|                         
  Fly   318 SGKPAAKKKKLSSTVALPPDISPTGSSDSLMRDKLMANNSSSPGSNVNAQMQSNANSTLETTEDD 382

  Fly   157 -------GRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTK 214
                   .|:.::.||.||..|:..||:.|..:||||.::|:::|:.|.::|||||.|:||||||
  Fly   383 SDSGSTDARRKKKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTK 447

  Fly   215 WKRQ-NQLRLEQLRHQATMEKDFVVQDGGGAGGLGCCPSGLSSSFSAAAAAAAAASN 270
            ||:| |....|...|:::..|.      |..|.....|||..:...::.|.:....|
  Fly   448 WKKQDNVTNNEAAEHKSSNAKP------GATGTATTTPSGEPTDKRSSNATSPTVGN 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 27/52 (52%)
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.