DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and isl1b

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001002043.1 Gene:isl1b / 415131 ZFINID:ZDB-GENE-040624-1 Length:323 Species:Danio rerio


Alignment Length:168 Identity:39/168 - (23%)
Similarity:60/168 - (35%) Gaps:42/168 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 EHKLQLSKSGRKPR-----RRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTW 207
            |.|..||.|..:.|     |.||..:..||..|:..:..........:..:.|...||...::.|
Zfish   155 EIKSTLSWSSMQRRSERATRVRTVLSETQLCMLQTCYTANPRPDALMKEQLVEMTGLSPRVIRVW 219

  Fly   208 YQNRRTKWK------RQNQLRLEQLRHQATME-----------------------KDFVVQDGGG 243
            :||:|.|.|      |..|.:||  .|..:.|                       .||::|:...
Zfish   220 FQNKRCKDKKRSLTMRHTQKQLE--GHLVSEEPLLLVSTESQDSDVMISPPWKLLTDFILQNEAE 282

  Fly   244 AGGLGCCPSGLS---SSFSAAAAAAAAASNPCNFLTSA 278
            ....   |..||   ....:|.:..|:.|:..|.||::
Zfish   283 HRSF---PQMLSLPTEGPCSAGSEVASVSDTANSLTAS 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 13/52 (25%)
isl1bNP_001002043.1 LIM1_Isl 19..73 CDD:188752
LIM 81..135 CDD:295319
HOX 174..228 CDD:197696 14/53 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.