DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Antp

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:111 Identity:37/111 - (33%)
Similarity:55/111 - (49%) Gaps:18/111 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 SGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSET 202
            |.|..|..|...:.|..|...:.|.|:| :|..|...||::|...:||:...|.::|..|.|:|.
  Fly   276 SSGMPSPLYPWMRSQFGKCQERKRGRQT-YTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTER 339

  Fly   203 QVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLG 248
            |:|.|:||||.|||::|:.:.|.                 |:||.|
  Fly   340 QIKIWFQNRRMKWKKENKTKGEP-----------------GSGGEG 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 22/52 (42%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 9/30 (30%)
Homeobox 301..354 CDD:395001 23/53 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.