DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and pb

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster


Alignment Length:319 Identity:75/319 - (23%)
Similarity:103/319 - (32%) Gaps:122/319 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 STPDSTAAGCQQELLLSHHHRRFTHHDESSVESCLSATRG----PGSGTGSGGGGGGGGGGGVAS 101
            |:.|:|:.|.|.:             .||.:.. |....|    |..|.|..|..||.||.||:.
  Fly     6 SSLDTTSMGTQIK-------------SESPLNP-LQVQTGQTSLPVGGCGGAGVVGGVGGVGVSV 56

  Fly   102 G--------------------------------------------------------LSAAAAAA 110
            |                                                        ||..:...
  Fly    57 GQPGIGQQGVPPVPSVLMVNKMTPNCDKRSADTAYWMTASEGGFINSQPSMAEFLNHLSPESPKI 121

  Fly   111 GVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGYAEHK------------LQLSKSGRK---- 159
            |...|      |||.|....|.....|.|.|...|.....            ::..|:.||    
  Fly   122 GTPVG------SGAIGGVGVNVNVNVGVGVGYPVGVVPQTPDGMDSVPEYPWMKEKKTSRKSSNN 180

  Fly   160 -----------------PRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTW 207
                             |||.|||:|:.||..||::|...|||....|.::|.:|:|:|.|||.|
  Fly   181 NNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVW 245

  Fly   208 YQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGC--C-------PSGLSSS 257
            :||||.|.|||...:.:...::.:::.|....|........|  |       |...|:|
  Fly   246 FQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQSDSNSNSKKSCQGCELPSDDIPDSTSNS 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 26/52 (50%)
pbNP_476669.3 COG5576 168..274 CDD:227863 35/105 (33%)
Homeobox 202..254 CDD:278475 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.