DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and LMX1A

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001167540.1 Gene:LMX1A / 4009 HGNCID:6653 Length:382 Species:Homo sapiens


Alignment Length:152 Identity:44/152 - (28%)
Similarity:68/152 - (44%) Gaps:29/152 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 AAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFR-- 180
            ||:.||.:.|.::...|..|:|.||:....:||        :|:|.||..|..|....:..|.  
Human   161 AASDSGKSDDEESLCKSAHGAGKGTAEEGKDHK--------RPKRPRTILTTQQRRAFKASFEVS 217

  Fly   181 ---CQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWK----RQNQLRLEQLRHQATMEKDFVV 238
               |:|.     |..:|....||...|:.|:||:|.|.|    ||.|.:.:|   |.|.......
Human   218 SKPCRKV-----RETLAAETGLSVRVVQVWFQNQRAKMKKLARRQQQQQQDQ---QNTQRLSSAQ 274

  Fly   239 QDGGGAGGLGCCPSGLSSSFSA 260
            .:|||:.|:    .|:.:.::|
Human   275 TNGGGSAGM----EGIMNPYTA 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 17/57 (30%)
LMX1ANP_001167540.1 LIM1_Lmx1a 35..86 CDD:188756
LIM2_Lmx1a_Lmx1b 94..148 CDD:188764
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..208 18/54 (33%)
Homeobox 198..252 CDD:395001 17/58 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..285 10/39 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.