DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and eyg

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001014582.1 Gene:eyg / 39419 FlyBaseID:FBgn0000625 Length:670 Species:Drosophila melanogaster


Alignment Length:209 Identity:61/209 - (29%)
Similarity:88/209 - (42%) Gaps:28/209 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 GSGTGSGGGGGGGGGG-----------GVASGL------SAAAAAAGVAAGLLAAA---ASGANG 126
            ||.|....|...||.|           .||:..      |||:|......|.|::|   |.||.|
  Fly   245 GSFTWHPAGNVPGGQGVPPPPPPSALWSVAAPTLANLPPSAASAVPVSTCGSLSSAHLMAGGAGG 309

  Fly   127 DRDANGGSGPGSGGGTSGGYAEHKLQLSK------SGRKPRRRRTAFTHAQLAYLERKFRCQKYL 185
             ...|....||||...:...|:....:..      ...|.||.||.|:..||..||::|....|.
  Fly   310 -TPTNRAISPGSGSHDTLESADENRHIDSDYLDDDDEPKFRRNRTTFSPEQLEELEKEFDKSHYP 373

  Fly   186 SVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGCC 250
            .|:.|..::...:|||.:|:.|:.|||.||:|..::.|.: |.:::.......|....|......
  Fly   374 CVSTRERLSSRTSLSEARVQVWFSNRRAKWRRHQRMNLLK-RQRSSPANPLHSQQSNDAPASSPT 437

  Fly   251 PSGLSSSFSAAAAA 264
            ||..||:.::|..|
  Fly   438 PSNHSSASTSAPVA 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 20/52 (38%)
eygNP_001014582.1 HTH 120..217 CDD:304362
Homeobox 352..404 CDD:278475 20/51 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.