DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and NKX1-2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001139812.1 Gene:NKX1-2 / 390010 HGNCID:31652 Length:310 Species:Homo sapiens


Alignment Length:288 Identity:96/288 - (33%)
Similarity:127/288 - (44%) Gaps:64/288 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RQTDSELELSNDDSDID-IEDRSTPDSTAAGCQQELLLSHHHRRFTHHDESSVESCLSATRGPGS 83
            |::.:|:|...|.|..| :....|||:...|..|...|        ...|:..|......|.|..
Human    47 RKSLAEVEAGKDASSRDPVRQLETPDAAGPGAGQASPL--------EGSEAEEEEDAEDPRRPRL 103

  Fly    84 GTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGP-GSGGGTSGGYA 147
            ..                  .||....|:|....|.|.:.|:|:...:||.|| .|..|:.|...
Human   104 RE------------------RAARLLPGLARSPDAPAGALASGEPCEDGGGGPVRSPPGSPGSPR 150

  Fly   148 EHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRR 212
            ..:.:|..:..||||.|||||:.||..||.|||..:||||.:|.::|.:|:|:|||||.|:||||
Human   151 PRRRRLEPNCAKPRRARTAFTYEQLVALENKFRATRYLSVCERLNLALSLSLTETQVKIWFQNRR 215

  Fly   213 TKWKRQNQLRLEQLRHQATMEKDFVVQDGGGA-----------GGLGCCPS--GLSS-------S 257
            ||||:||.            ..|...|.||||           ||.|..|.  |..:       |
Human   216 TKWKKQNP------------GADGAAQVGGGAPQPGAAGGGGGGGSGGSPGPPGTGALHFQTFPS 268

  Fly   258 FSAA-AAAAAAASNPCNFLTSAAAAAIF 284
            :||| ....:|||.|   ||:||..:.|
Human   269 YSAANVLFPSAASFP---LTAAAPGSPF 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 32/52 (62%)
NKX1-2NP_001139812.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..165 34/143 (24%)
Homeobox 167..219 CDD:278475 32/51 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 217..260 16/54 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4961
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.