DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Dbx

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_647677.2 Gene:Dbx / 38254 FlyBaseID:FBgn0261723 Length:741 Species:Drosophila melanogaster


Alignment Length:267 Identity:66/267 - (24%)
Similarity:92/267 - (34%) Gaps:115/267 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LSH------HHRRFTH----HDESSVE-SCLSATRGPGS-----------GTGSGGGGGGGGGGG 98
            |:|      ||::..|    |..:|.: ...|::..|||           .|.:|.|.|.|..|.
  Fly   247 LTHQLPPHQHHQQQQHVQQQHPGNSCQPQTASSSSSPGSTISDSDNNHGASTANGNGSGTGNSGQ 311

  Fly    99 VASGLSAAAAAAGVAAGLLAAAASGANGDRDAN------------------GGSGPGSGGGTSGG 145
            .|.....|                .:|.|.|::                  ||:|.|.|||...|
  Fly   312 DARPHELA----------------NSNPDEDSSASRRLTQDKQQQQQLLGAGGTGGGGGGGHGHG 360

  Fly   146 -----------------------YAEHKLQ--------------------------------LSK 155
                                   :..|.|.                                .:.
  Fly   361 HPTPPPPPPPPVIAKPMPSRPTPFLPHTLNHPHLHSLLAHCRNPYMSVGAQVFPLPPGQGFPWAH 425

  Fly   156 SGR-KPRR---RRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWK 216
            |.| ||||   ||..|:.:|...||::|:.|||:|..||..:||.|.|.::|||.|:||||.||:
  Fly   426 STRGKPRRGMMRRAVFSDSQRKGLEKRFQQQKYISKPDRKKLAERLGLKDSQVKIWFQNRRMKWR 490

  Fly   217 RQNQLRL 223
            ...:..|
  Fly   491 NSKEREL 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 26/52 (50%)
DbxNP_647677.2 Homeobox 437..490 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.