DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and gsb

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster


Alignment Length:330 Identity:78/330 - (23%)
Similarity:123/330 - (37%) Gaps:93/330 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IRDLLGDLINRRQTDSELELSNDDSDIDIEDRSTPDSTAAGCQ-----QELLLSHHHRRFTHHDE 68
            :..|.|..||.|...:.:.            |...:..|||.:     ::|.:||          
  Fly    23 VNQLGGVFINGRPLPNHIR------------RQIVEMAAAGVRPCVISRQLRVSH---------- 65

  Fly    69 SSVESCLSATRGPGSGTGSGGGGGGGGG----------------------------------GGV 99
                .|:|........|||...|..||.                                  .||
  Fly    66 ----GCVSKILNRFQETGSIRPGVIGGSKPRVATPDIESRIEELKQSQPGIFSWEIRAKLIEAGV 126

  Fly   100 ASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGG--TSGGYAEHKLQLSKSGRKPRR 162
            ....:|.:.:: ::..|..::.||.:...|...|.|.||.|.  .|...||..:||.   ||.||
  Fly   127 CDKQNAPSVSS-ISRLLRGSSGSGTSHSIDGILGGGAGSVGSEDESEDDAEPSVQLK---RKQRR 187

  Fly   163 RRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLR 227
            .||.|::.|:..|||.|...:|..|..|.::|::..|:|.:|:.|:.|||.:.::  ||..:|:.
  Fly   188 SRTTFSNDQIDALERIFARTQYPDVYTREELAQSTGLTEARVQVWFSNRRARLRK--QLNTQQVP 250

  Fly   228 HQATMEKDFVVQDGGGAGGLGCCPS---GLS--SSFS----------AAAAAAAAASNPCNFLTS 277
            ..|.....|     |........|:   |:|  ||.|          ||...:.|:.:|.:..:.
  Fly   251 SFAPTSTSF-----GATPTTSAAPAPNMGMSLYSSQSWPSSGAYENHAAYGGSVASMSPASSTSG 310

  Fly   278 AAAAA 282
            .::||
  Fly   311 TSSAA 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 19/52 (37%)
gsbNP_523863.1 PAX 19..143 CDD:128645 23/146 (16%)
homeodomain 186..243 CDD:238039 21/58 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.