DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and ved

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_898897.1 Gene:ved / 368201 ZFINID:ZDB-GENE-030813-1 Length:278 Species:Danio rerio


Alignment Length:337 Identity:79/337 - (23%)
Similarity:118/337 - (35%) Gaps:127/337 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QSSKSFLIRDLLGDLINRRQTDSELELSNDDS-------------DIDIEDRSTPDSTAAGCQQE 53
            |||.|  :||       .:||.|    ::.||             :..:|::.|.:..   .|::
Zfish    12 QSSSS--VRD-------EQQTSS----TSTDSLPGSYSRWTSPHMEKHMEEKYTEEKY---LQEK 60

  Fly    54 LLLSHHHRRFT-----------------HHDESSVESCLSATRGPGSGTGSGGGGGGGGGGGVAS 101
            .:....|.::|                 |..||...|  |......||..|.|....|.|     
Zfish    61 SMEKFMHEKYTEEKHMPEKYTEGKRIQKHTHESGFSS--STEDEELSGCESEGSRSEGSG----- 118

  Fly   102 GLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTA 166
              |.:.||.|..|                     |.||.|:           ..|||:|   |||
Zfish   119 --SRSPAAPGSVA---------------------PASGSGS-----------PSSGRRP---RTA 146

  Fly   167 FTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQAT 231
            |:..|::.|||.|:...||...|::::..||.|::.|::.|:||||.|.||..|..|.|      
Zfish   147 FSSEQISSLERVFKRNAYLGAQDKAELCRTLKLTDKQIRNWFQNRRMKLKRTVQDSLAQ------ 205

  Fly   232 MEKDFVVQDGGGAGGLGCCPSGLSS---------SFSAAAAAAAAASNPCNF-----LTSAAAAA 282
                             .|...::|         ||.||...:.....|..|     ::.||.:.
Zfish   206 -----------------ACQVKVASHMMHYSDLHSFRAAPYPSFYPETPAAFAPPYPISPAAESL 253

  Fly   283 IFRNVGYVHGCP 294
            .:.:...:.|.|
Zfish   254 YYSSYQNLQGVP 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 22/52 (42%)
vedNP_898897.1 Homeobox 145..196 CDD:278475 21/50 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.