DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and PDX1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_000200.1 Gene:PDX1 / 3651 HGNCID:6107 Length:283 Species:Homo sapiens


Alignment Length:171 Identity:52/171 - (30%)
Similarity:73/171 - (42%) Gaps:44/171 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 ANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVA 194
            |:...|..:||..:....|:|           |.|||:|.|||..||::|...||:|...|.::|
Human   127 AHAWKGQWAGGAYAAEPEENK-----------RTRTAYTRAQLLELEKEFLFNKYISRPRRVELA 180

  Fly   195 ETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATM---------EKDFVVQDG--------- 241
            ..|||:|..:|.|:||||.|||::.    ::.|...|.         |:|..|..|         
Human   181 VMLNLTERHIKIWFQNRRMKWKKEE----DKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPPP 241

  Fly   242 ---GG--------AGGLGCCPSGLSSSFSAAAAAAAAASNP 271
               ||        |...|..|.|||:|...::.|......|
Human   242 PPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQEP 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 26/52 (50%)
PDX1NP_000200.1 Transactivation domain. /evidence=ECO:0000250 13..73
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..71
Antp-type hexapeptide 118..123
Homeobox 149..202 CDD:278475 26/52 (50%)
Nuclear localization signal. /evidence=ECO:0000250 197..203 4/5 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..283 19/86 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.