DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and en

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_523700.2 Gene:en / 36240 FlyBaseID:FBgn0000577 Length:552 Species:Drosophila melanogaster


Alignment Length:196 Identity:52/196 - (26%)
Similarity:82/196 - (41%) Gaps:45/196 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 SSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAA------------ 121
            :|..|.:|:|....:.:.|...|.......:.|..|:...|:|  :|:.|::.            
  Fly   332 ASNASTISSTSSVATSSSSSSSGCSSAASSLNSSPSSRLGASG--SGVNASSPQPQPIPPPSAVS 394

  Fly   122 --SGANGDRDANGGSGPGSGGGTSGG---------YAEHKLQLSKSG---RKP----------RR 162
              ||.....|....:|..:   |.||         |.........||   |:|          :|
  Fly   395 RDSGMESSDDTRSETGSTT---TEGGKNEMWPAWVYCTRYSDRPSSGPRYRRPKQPKDKTNDEKR 456

  Fly   163 RRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKR----QNQLRL 223
            .||||:..|||.|:|:|...:||:...|..::..|.|:|.|:|.|:||:|.|.|:    :|.|.|
  Fly   457 PRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKSTGSKNPLAL 521

  Fly   224 E 224
            :
  Fly   522 Q 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 23/52 (44%)
enNP_523700.2 Homeobox 457..510 CDD:278475 23/52 (44%)
Engrail_1_C_sig 512..541 CDD:287495 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.