DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Lim3

DIOPT Version :10

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001260559.1 Gene:Lim3 / 35184 FlyBaseID:FBgn0002023 Length:555 Species:Drosophila melanogaster


Alignment Length:78 Identity:25/78 - (32%)
Similarity:35/78 - (44%) Gaps:6/78 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 YAEHK-----LQLSKSGRKPRRR-RTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQV 204
            |.|.|     |..|..|.:|.:| ||..|..||..|:..:......:...|..:::...|....|
  Fly   236 YEEAKAKGLYLDGSLDGDQPNKRPRTTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVV 300

  Fly   205 KTWYQNRRTKWKR 217
            :.|:||||.|.||
  Fly   301 QVWFQNRRAKEKR 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeodomain 161..217 CDD:459649 16/56 (29%)
Lim3NP_001260559.1 LIM1_Lhx3_Lhx4 122..173 CDD:188754
LIM2_Lhx3_Lhx4 181..236 CDD:188762 25/78 (32%)
Homeodomain 257..313 CDD:459649 16/55 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.