DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and prd

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster


Alignment Length:196 Identity:52/196 - (26%)
Similarity:82/196 - (41%) Gaps:52/196 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 VASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGT----------SGGY------- 146
            :..|:...:.|..|:|.........|..|.|.:..||..:|.||          |||:       
  Fly   130 IREGVCDRSTAPSVSAISRLVRGRDAPLDNDMSSASGSPAGDGTKASSSCGSDVSGGHHNNGKPS 194

  Fly   147 --------AEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQ 203
                    :|..:.|.   ||.||.||.|:.:||..|||.|...:|..:..|.::|:..||:|.:
  Fly   195 DEDISDCESEPGIALK---RKQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEAR 256

  Fly   204 VKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGCCPSGLSSSFSAAAAAAAAA 268
            ::.|:.|||.:.::|         |.:.         .|||      |.|.::|.|..||:::..
  Fly   257 IQVWFSNRRARLRKQ---------HTSV---------SGGA------PGGAAASVSHVAASSSLP 297

  Fly   269 S 269
            |
  Fly   298 S 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 19/52 (37%)
prdNP_723721.1 PAX 27..154 CDD:238076 4/23 (17%)
Homeobox 217..269 CDD:278475 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.