DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and BARHL2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_064447.1 Gene:BARHL2 / 343472 HGNCID:954 Length:387 Species:Homo sapiens


Alignment Length:313 Identity:88/313 - (28%)
Similarity:102/313 - (32%) Gaps:139/313 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSKSFLIRDLLGDLINRRQTDSELELSNDDSDIDIEDRSTPDSTAAGCQQELLLSHH-------- 59
            |:.||||:|:|||                         |.|.:..|.....:...||        
Human   138 STSSFLIKDILGD-------------------------SKPLAACAPYSTSVSSPHHTPKQESNA 177

  Fly    60 -HRRF--------------THHDESSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAA 109
             |..|              ...|..|...|        .||..                      
Human   178 VHESFRPKLEQEDSKTKLDKREDSQSDIKC--------HGTKE---------------------- 212

  Fly   110 AGVAAGLLAAAASGANGDRDANGG--SGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQL 172
                           .|||:....  |.|                  ...:|||:.||||:..||
Human   213 ---------------EGDREITSSRESPP------------------VRAKKPRKARTAFSDHQL 244

  Fly   173 AYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFV 237
            ..|||.|..||||||.||.|:|..|||::|||||||||||||||||..:.||.|..         
Human   245 NQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQNRRTKWKRQTAVGLELLAE--------- 300

  Fly   238 VQDGGGAGGLGCC-----------PSGLSSSFSAAAAAAAAASNPCNFLTSAA 279
                  ||.....           ||.|.|..|..|||||||.....:.|..|
Human   301 ------AGNYSALQRMFPSPYFYHPSLLGSMDSTTAAAAAAAMYSSMYRTPPA 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 36/52 (69%)
BARHL2NP_064447.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..145 4/6 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..240 21/145 (14%)
Homeobox 236..288 CDD:278475 36/51 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 367..387
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1387
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.