DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and UNCX

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001073930.1 Gene:UNCX / 340260 HGNCID:33194 Length:531 Species:Homo sapiens


Alignment Length:199 Identity:58/199 - (29%)
Similarity:73/199 - (36%) Gaps:68/199 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LLSHHHRRFTHHDESSVESCLSATRGPGSGTGSGGGGGGGGGGGVAS----------------GL 103
            ||.|.|.:|                             ||..|||..                .|
Human     6 LLEHPHAQF-----------------------------GGSLGGVVGFPYPLGHHHVYELAGHQL 41

  Fly   104 SAAAAAA-------GVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGR--- 158
            .:|||||       |:..|..|||||..|.........|.|..|        ...:||.||.   
Human    42 QSAAAAASVPFSIDGLLGGSCAAAASVVNPTPLLPAACGVGGDG--------QPFKLSDSGDPDK 98

  Fly   159 -----KPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQ 218
                 |.||.||.||..||..||:.|....|..|..|..:|..|:|.|::|:.|:||||.||:::
Human    99 ESPGCKRRRTRTNFTGWQLEELEKAFNESHYPDVFMREALALRLDLVESRVQVWFQNRRAKWRKK 163

  Fly   219 NQLR 222
            ...:
Human   164 ENTK 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 23/52 (44%)
UNCXNP_001073930.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..107 5/19 (26%)
Homeobox 108..161 CDD:306543 23/52 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..312 0/7 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..344
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..531
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.