DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and scro

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster


Alignment Length:417 Identity:102/417 - (24%)
Similarity:147/417 - (35%) Gaps:147/417 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSKSFLIRDLLGDLINRRQTDSELELSNDDSDIDIEDRSTPD--STAAGCQQELLLSHHHRRFT- 64
            |.|..||...:.   ...|.|:..:|:.:::       ||.:  ||||..    .::|||...: 
  Fly    42 SPKDTLIHTAIS---QHHQVDTSTKLNTNET-------STQNTVSTAAAA----AVAHHHHNLSS 92

  Fly    65 -HHDE-------------------------SSVE-------------------SCLSATRGPGSG 84
             ||.:                         |.:|                   |..|:...||:.
  Fly    93 IHHLQNLHSQHQSTLFNSNHSTPFSVTDILSPIEESYRKLELNGNPPSPFRSNSSSSSINSPGTL 157

  Fly    85 TGSGGGGGGGGG-----GGVAS--GLSAAAAAAGVAAGLLAAAA---SGANGDRDA------NGG 133
            |.|........|     .||.:  |.:...:.||....:..:|:   |.||..|.|      :..
  Fly   158 TTSTMANPYAMGTLYHSPGVQTYCGPTDNLSLAGHYTDMRNSASWYGSTANDPRFAISRLMSSSA 222

  Fly   134 SGPGSGGGTSGGYAEHKLQLSKSGRKP----RRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVA 194
            ||..|..|...|.|...:..||..:.|    |:||..||.||:..|||:|:.|:|||..:|..:|
  Fly   223 SGTMSHMGNMSGLAACSVSDSKPLQFPLAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLA 287

  Fly   195 ETLNLSETQVKTWYQNRRTKWKRQ--NQLRLEQLRHQATMEK------DFVVQDG---------- 241
            ..::|:.||||.|:||.|.|.|||  .:...||.:|......      ..:|:||          
  Fly   288 SLIHLTPTQVKIWFQNHRYKCKRQAKEKAMAEQNQHNQPASSPRRVAVPVLVKDGKPCSGNNSSS 352

  Fly   242 ---------------------GGA------------GGL----GCCPSGLSSSFSAAAAAA---- 265
                                 |.|            |||    |..|:..|...|::..|:    
  Fly   353 QSQQHGTNSTSAGNNTGSANNGNANSGIVSVTANVSGGLNLITGDAPNSHSPDTSSSLLASYGTV 417

  Fly   266 -----AAASNPC-NFLTSAAAAAIFRN 286
                 |....|| |.|.|.:.|..:||
  Fly   418 GGSNVAMLQQPCNNTLMSNSLAMAYRN 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 26/52 (50%)
scroNP_001015473.1 Homeobox 256..309 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.