DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and AgaP_AGAP008024

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_317437.4 Gene:AgaP_AGAP008024 / 3291638 VectorBaseID:AGAP008024 Length:94 Species:Anopheles gambiae


Alignment Length:95 Identity:32/95 - (33%)
Similarity:49/95 - (51%) Gaps:15/95 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 SGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLN 198
            |||.....::...|:.|           |.||||:..|||.|:.:|...:||:...|..::..|.
Mosquito     9 SGPAQQSASAAALADDK-----------RPRTAFSGPQLARLKHEFAENRYLTERRRQQLSAELG 62

  Fly   199 LSETQVKTWYQNRRTKWKR----QNQLRLE 224
            |:|.|:|.|:||:|.|.|:    :|.|.|:
Mosquito    63 LNEAQIKIWFQNKRAKIKKSSGQKNPLALQ 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 22/52 (42%)
AgaP_AGAP008024XP_317437.4 Homeobox 27..80 CDD:278475 22/52 (42%)
Engrail_1_C_sig 82..>94 CDD:287495 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.