DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and AgaP_AGAP002431

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_563754.3 Gene:AgaP_AGAP002431 / 3290618 VectorBaseID:AGAP002431 Length:622 Species:Anopheles gambiae


Alignment Length:204 Identity:53/204 - (25%)
Similarity:77/204 - (37%) Gaps:58/204 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 HHHRRFTHHDES----------------SVESCLSATRGPGSGTGSGGGG--------------- 91
            |||.....|.:|                |.::.:|.|:...| |.|...|               
Mosquito   414 HHHHNHQGHPQSHQGGAQGAPHSGPVSPSQQTAVSQTQTHAS-TASNPHGIDTILSRPPPVTTAQ 477

  Fly    92 GGGGGGGVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGS--------GPGSGGGTSGGYA- 147
            ....|||:....:|.||||.:|..|  :..:.|||...|:.|.        .||..|..:...| 
Mosquito   478 LNALGGGMPRFTAAVAAAANMAQYL--SQQNHANGPMKAHAGPLVDRTHLYWPGLQGLVANPMAW 540

  Fly   148 -------------EHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNL 199
                         .|..| .|.|:|...|.| |:..|:..||:.|...|||:..:|:.:|..|.:
Mosquito   541 RDRLGSMSASLSQSHHAQ-DKDGKKKHTRPT-FSGQQIFALEKTFEQTKYLAGPERAKLAYALGM 603

  Fly   200 SETQVKTWY 208
            :|:|||..:
Mosquito   604 TESQVKVGF 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 17/46 (37%)
AgaP_AGAP002431XP_563754.3 Homeobox 567..612 CDD:278475 17/45 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.