Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_067015.2 | Gene: | HOXD11 / 3237 | HGNCID: | 5134 | Length: | 338 | Species: | Homo sapiens |
Alignment Length: | 255 | Identity: | 69/255 - (27%) |
---|---|---|---|
Similarity: | 88/255 - (34%) | Gaps: | 109/255 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 79 RGPGSG-------TGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAA---------------- 120
Fly 121 --------------------------ASGANG--------------------------------- 126
Fly 127 ---DR-----DANGGSG----------------PGSGGGTSGGYAEHKLQLSKSGRKP---RRRR 164
Fly 165 TAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLE 224 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 21/52 (40%) |
HOXD11 | NP_067015.2 | DUF3528 | 26..185 | CDD:288866 | 29/108 (27%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 179..270 | 15/90 (17%) | |||
Homeobox | 269..322 | CDD:278475 | 21/52 (40%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |