Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_059106.2 | Gene: | HOXC13 / 3229 | HGNCID: | 5125 | Length: | 330 | Species: | Homo sapiens |
Alignment Length: | 309 | Identity: | 62/309 - (20%) |
---|---|---|---|
Similarity: | 87/309 - (28%) | Gaps: | 167/309 - (54%) |
- Green bases have known domain annotations that are detailed below.
Fly 66 HDESSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAA----------------------- 107
Fly 108 ---------AAAGVAAGLL-------------------AAAASGANGDRDANGGS---------- 134
Fly 135 ---------GPG------SGG------------------------------------GTSG---- 144
Fly 145 ---------GYA--------EHKLQLSK------------------------SGRKPRRRRTAFT 168
Fly 169 HAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKR 217 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 21/52 (40%) |
HOXC13 | NP_059106.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 30..50 | 12/19 (63%) | |
HoxA13_N | 54..166 | CDD:315049 | 12/111 (11%) | ||
HOX | 260..312 | CDD:197696 | 19/51 (37%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |