DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and HOXC13

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_059106.2 Gene:HOXC13 / 3229 HGNCID:5125 Length:330 Species:Homo sapiens


Alignment Length:309 Identity:62/309 - (20%)
Similarity:87/309 - (28%) Gaps:167/309 - (54%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 HDESSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAA----------------------- 107
            :::|:.|          ||.|.||||||||.||...|.|.|:                       
Human    19 YEDSAAE----------SGIGGGGGGGGGGTGGAGGGCSGASPGKAPSMDGLGSSCPASHCRDLL 73

  Fly   108 ---------AAAGVAAGLL-------------------AAAASGANGDRDANGGS---------- 134
                     |..|...|.:                   ..::|...|.....|||          
Human    74 PHPVLGRPPAPLGAPQGAVYTDIPAPEAARQCAPPPAPPTSSSATLGYGYPFGGSYYGCRLSHNV 138

  Fly   135 ---------GPG------SGG------------------------------------GTSG---- 144
                     .||      ||.                                    |.||    
Human   139 NLQQKPCAYHPGDKYPEPSGALPGDDLSSRAKEFAFYPSFASSYQAMPGYLDVSVVPGISGHPEP 203

  Fly   145 ---------GYA--------EHKLQLSK------------------------SGRKPRRRRTAFT 168
                     ||.        :.::..||                        |.|:.|::|..:|
Human   204 RHDALIPVEGYQHWALSNGWDSQVYCSKEQSQSAHLWKSPFPDVVPLQPEVSSYRRGRKKRVPYT 268

  Fly   169 HAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKR 217
            ..||..||:::...|:::...|..::.|.||||.||..|:||||.|.|:
Human   269 KVQLKELEKEYAASKFITKEKRRRISATTNLSERQVTIWFQNRRVKEKK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 21/52 (40%)
HOXC13NP_059106.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..50 12/19 (63%)
HoxA13_N 54..166 CDD:315049 12/111 (11%)
HOX 260..312 CDD:197696 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.