DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and HOXC12

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_776272.1 Gene:HOXC12 / 3228 HGNCID:5124 Length:282 Species:Homo sapiens


Alignment Length:189 Identity:58/189 - (30%)
Similarity:80/189 - (42%) Gaps:61/189 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 RGPGSGTG--------------------SGGGGGGGGGGGVA---SGLSAAAAAAGVAAGLLAAA 120
            |.||:|.|                    :.|||||.||||..   ...|..:..:..::.||...
Human   114 RDPGAGPGAALLPLEPSGPPALGFKYDYAAGGGGGDGGGGAGPPHDPPSCQSLESDSSSSLLNEG 178

  Fly   121 ASGANGDRDANGGSGPGS-------GGGTSGGYAEHKLQLSKSG-------RKPRRRRTAFTHAQ 171
            ..||       |...|||       |||           ||.||       .:.|::|..::..|
Human   179 NKGA-------GAGDPGSLVSPLNPGGG-----------LSASGAPWYPINSRSRKKRKPYSKLQ 225

  Fly   172 LAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQA 230
            ||.||.:|...::::...|.::::.||||:.|||.|:||||.|.||.      .||.||
Human   226 LAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKRL------LLREQA 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 21/52 (40%)
HOXC12NP_776272.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..129 5/14 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..214 22/84 (26%)
homeodomain 215..271 CDD:238039 22/55 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.