DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and HOXC11

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_055027.1 Gene:HOXC11 / 3227 HGNCID:5123 Length:304 Species:Homo sapiens


Alignment Length:225 Identity:57/225 - (25%)
Similarity:95/225 - (42%) Gaps:41/225 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DLINRR----QTDSELELSNDDSDIDIEDRSTPDSTAAG----CQQELLLSHHHRRFTHHDESSV 71
            :|::|.    .|.:|:.:.|:.|.......|.|.:|.||    ..:..:|.....||..:     
Human    98 ELMHRECLPPSTVTEILMKNEGSYGGHHHPSAPHATPAGFYSSVNKNSVLPQAFDRFFDN----- 157

  Fly    72 ESCLSATRGPGSGTGSGGGGGGG-------GGGGVASGLSAAAAAAGVAAGLLAAAASGANGDRD 129
            ..|                |||.       .|.|.|.|...|..|:|:|    :.|.:||..:.:
Human   158 AYC----------------GGGDPPAEPPCSGKGEAKGEPEAPPASGLA----SRAEAGAEAEAE 202

  Fly   130 ANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVA 194
            .. .:.|.|.|.......|.....:.:..:.|::|..::..|:..|||:|....|::...|..::
Human   203 EE-NTNPSSSGSAHSVAKEPAKGAAPNAPRTRKKRCPYSKFQIRELEREFFFNVYINKEKRLQLS 266

  Fly   195 ETLNLSETQVKTWYQNRRTKWKRQNQLRLE 224
            ..|||::.|||.|:||||.|.|:.::.||:
Human   267 RMLNLTDRQVKIWFQNRRMKEKKLSRDRLQ 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 20/52 (38%)
HOXC11NP_055027.1 DUF3528 42..178 CDD:288866 20/100 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..237 16/75 (21%)
Homeobox 235..288 CDD:278475 20/52 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.