DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and HOXB2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_002136.1 Gene:HOXB2 / 3212 HGNCID:5113 Length:356 Species:Homo sapiens


Alignment Length:180 Identity:60/180 - (33%)
Similarity:78/180 - (43%) Gaps:47/180 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 SAAAAAAGVAAGLLAAAASGANGDRDANGGSG-PGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAF 167
            |.:|.:...||..:.|:..|:..|     |.| |.:|||.:                 ||.|||:
Human   108 SQSATSPSPAASAVPASGVGSPAD-----GLGLPEAGGGGA-----------------RRLRTAY 150

  Fly   168 THAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATM 232
            |:.||..||::|...|||....|.::|..|:|:|.|||.|:||||.|.|||.|.|          
Human   151 TNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQHR---------- 205

  Fly   233 EKDFVVQDGGGAGGLGCCPSGLSSSFSAAAAAAAAASNPCNFLTSAAAAA 282
                ...||..|     ||..|......|...||:...|     ||:.||
Human   206 ----EPPDGEPA-----CPGALEDICDPAEEPAASPGGP-----SASRAA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 26/52 (50%)
HOXB2NP_002136.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..142 12/38 (32%)
Antp-type hexapeptide 94..99
Homeobox 147..199 CDD:278475 26/51 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..240 18/66 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.