DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and HOXB1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_002135.2 Gene:HOXB1 / 3211 HGNCID:5111 Length:301 Species:Homo sapiens


Alignment Length:174 Identity:54/174 - (31%)
Similarity:75/174 - (43%) Gaps:29/174 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 SATRGP------GSGTGSGG----GGGGGGGGGVASGLSAAAAAAG------------VAAGLLA 118
            |.:.||      |...|.||    ...|...||::.|..|..|..|            ..|....
Human    90 SPSYGPSQYYPLGQSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPGPYPPQHPPYGNEQTASFAP 154

  Fly   119 AAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGR-------KPRRRRTAFTHAQLAYLE 176
            |.|...:.|::....|.|.:....:..:.:.|....|:.:       .|...||.||..||..||
Human   155 AYADLLSEDKETPCPSEPNTPTARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELE 219

  Fly   177 RKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQ 220
            ::|...||||.|.|.::|.||.|:|||||.|:||||.|.|::.:
Human   220 KEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKKRER 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 30/52 (58%)
HOXB1NP_002135.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..77
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..149 3/21 (14%)
Antp-type hexapeptide 179..184 0/4 (0%)
Homeobox 207..259 CDD:278475 30/51 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..301 4/10 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.