DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and HOXA7

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_008827.2 Gene:HOXA7 / 3204 HGNCID:5108 Length:230 Species:Homo sapiens


Alignment Length:220 Identity:63/220 - (28%)
Similarity:84/220 - (38%) Gaps:56/220 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SCLSATRGPGSGTGSGGGGGGGGGGGV------------ASGLSAAAAAAG---------VAAGL 116
            ||..|.....||.|:|.|.......|:            |||....|.|.|         ...||
Human    28 SCSFAPNSQRSGYGAGAGAFASTVPGLYNVNSPLYQSPFASGYGLGADAYGNLPCASYDQNIPGL 92

  Fly   117 LAAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQ----LSKSGRKPRRRRTAFTHAQLAYLER 177
            .:..|.||....|.          |...|.||...:    :..||...:|.|..:|..|...||:
Human    93 CSDLAKGACDKTDE----------GALHGAAEANFRIYPWMRSSGPDRKRGRQTYTRYQTLELEK 147

  Fly   178 KFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGG 242
            :|...:||:...|.::|..|.|:|.|:|.|:||||.|||:::              ||    :|.
Human   148 EFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEH--------------KD----EGP 194

  Fly   243 GAGGLGCCPSGLSSSFSAAAAAAAA 267
            .|   ...|.|...|.:|.|||..|
Human   195 TA---AAAPEGAVPSAAATAAADKA 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 21/52 (40%)
HOXA7NP_008827.2 Antp-type hexapeptide 119..124 0/4 (0%)
Homeobox 134..186 CDD:278475 21/51 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..230 12/51 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.