Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002132.3 | Gene: | HOXA4 / 3201 | HGNCID: | 5105 | Length: | 320 | Species: | Homo sapiens |
Alignment Length: | 299 | Identity: | 71/299 - (23%) |
---|---|---|---|
Similarity: | 94/299 - (31%) | Gaps: | 133/299 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 GSGTGSGGGGGGGG----------------------GGGVASGLSAAAAAAGVAAGLLAAAASGA 124
Fly 125 NGDRDA------NGGSGPG-----------SGGGTSGGYAEHKLQ-------------------- 152
Fly 153 --------------------------------------------------LSKSGRKPRRRRTAF 167
Fly 168 THAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATM 232
Fly 233 EKDFVVQDGGGAGGLGCCPSGLSSSFSAAAAAAAAASNP 271 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 26/52 (50%) |
HOXA4 | NP_002132.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 19..77 | 14/48 (29%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 101..168 | 10/66 (15%) | |||
Antp-type hexapeptide | 194..199 | 0/4 (0%) | |||
Homeobox | 218..271 | CDD:278475 | 26/52 (50%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 273..320 | 9/54 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |