DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and HOXA4

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_002132.3 Gene:HOXA4 / 3201 HGNCID:5105 Length:320 Species:Homo sapiens


Alignment Length:299 Identity:71/299 - (23%)
Similarity:94/299 - (31%) Gaps:133/299 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 GSGTGSGGGGGGGG----------------------GGGVASGLSAAAAAAGVAAGLLAAAASGA 124
            |||...||.|||.|                      |||.....|..|..........|||...|
Human    28 GSGGADGGPGGGPGYQQPPAPPTQHLPLQQPQLPHAGGGREPTASYYAPRTAREPAYPAAALYPA 92

  Fly   125 NGDRDA------NGGSGPG-----------SGGGTSGGYAEHKLQ-------------------- 152
            :|..|.      .||:.||           :.|...|.:|.|.||                    
Human    93 HGAADTAYPYGYRGGASPGRPPQPEQPPAQAKGPAHGLHASHVLQPQLPPPLQPRAVPPAAPRRC 157

  Fly   153 --------------------------------------------------LSKSGRKPRRRRTAF 167
                                                              .|.:|.:|:|.|||:
Human   158 EAAPATPGVPAGGSAPACPLLLADKSPLGLKGKEPVVYPWMKKIHVSAVNPSYNGGEPKRSRTAY 222

  Fly   168 THAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATM 232
            |..|:..||::|...:||:...|.::|.||.|||.|||.|:||||.|||:.::|...::|     
Human   223 TRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPNTKMR----- 282

  Fly   233 EKDFVVQDGGGAGGLGCCPSGLSSSFSAAAAAAAAASNP 271
                               |..|:|.||.....|...:|
Human   283 -------------------SSNSASASAGPPGKAQTQSP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 26/52 (50%)
HOXA4NP_002132.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..77 14/48 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..168 10/66 (15%)
Antp-type hexapeptide 194..199 0/4 (0%)
Homeobox 218..271 CDD:278475 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..320 9/54 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.